S100A1 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7349
Artikelname: S100A1 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7349
Hersteller Artikelnummer: P7349
Alternativnummer: ABN-P7349-5
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human S100A1 (P23297, 1 a.a. - 200 a.a ) full-length recombinant protein expressed in Escherichia coli.
Tag: with N-terminal His tagged
UniProt: 6271
Puffer: Lyophilized from 20 mM Tris-HCl, 0.1 mM EDTA, pH 7.0. Reconstitute the lyophilized powder in ddH2O at 200 µg/ml.
Formulierung: Lyophilized
Sequenz: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Target-Kategorie: S100A1
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.