S100A1 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P7350
- Bilder (0)
Artikelname: | S100A1 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P7350 |
Hersteller Artikelnummer: | P7350 |
Alternativnummer: | ABN-P7350-50 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human S100A1 (P23297, 1 a.a. - 200 a.a ) full-length recombinant protein expressed in Escherichia coli. |
Tag: | with N-terminal His tagged |
UniProt: | 6271 |
Puffer: | Lyophilized from 20 mM Tris-HCl, 0.1 mM EDTA, pH 7.0. Reconstitute the lyophilized powder in ddH2O at 200 µg/ml. |
Formulierung: | Lyophilized |
Sequenz: | MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
Target-Kategorie: | S100A1 |
Application Verdünnung: | SDS-PAGEThe optimal working dilution should be determined by the end user. |