Pdgfb (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P7356
Artikelname: Pdgfb (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P7356
Hersteller Artikelnummer: P7356
Alternativnummer: ABN-P7356-10
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Pdgfb (P31240, 82 a.a. - 190 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 18591
Puffer: Lyophilized from 10 mM sodium citrate, pH 3.0. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
Target-Kategorie: Pdgfb
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.