Tnfsf18 (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P7358
Artikelname: Tnfsf18 (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P7358
Hersteller Artikelnummer: P7358
Alternativnummer: ABN-P7358-10
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Tnfsf18 (Q7TS55, 47 a.a. - 173 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 240873
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS
Target-Kategorie: Tnfsf18
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.