BTC (Human) Recombinant Protein
Artikelnummer:
ABN-P7361
- Bilder (0)
| Artikelname: | BTC (Human) Recombinant Protein |
| Artikelnummer: | ABN-P7361 |
| Hersteller Artikelnummer: | P7361 |
| Alternativnummer: | ABN-P7361-10 |
| Hersteller: | Abnova |
| Wirt: | Human |
| Kategorie: | Proteine/Peptide |
| Applikation: | FA, SDS-PAGE |
| Spezies Reaktivität: | Human |
| Human BTC (P35070, 32 a.a. - 111 a.a ) partial recombinant protein expressed in HEK293 cells. |
| UniProt: | 685 |
| Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Formulierung: | Lyophilized |
| Sequenz: | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY |
| Target-Kategorie: | BTC |
| Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
Produktgarantie und fachkundiger Support
