TNFRSF1A (Human) Recombinant Protein, Mammal
Artikelnummer:
ABN-P7363
- Bilder (0)
Artikelname: | TNFRSF1A (Human) Recombinant Protein, Mammal |
Artikelnummer: | ABN-P7363 |
Hersteller Artikelnummer: | P7363 |
Alternativnummer: | ABN-P7363-10 |
Hersteller: | Abnova |
Wirt: | Mammal |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human TNFRSF1A (P19438, 50 a.a. - 211 a.a ) partial recombinant protein expressed in CHO cells. |
UniProt: | 7132 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Formulierung: | Lyophilized |
Sequenz: | IHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT |
Target-Kategorie: | TNFRSF1A |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |