FIGF (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P7373
Artikelname: FIGF (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P7373
Hersteller Artikelnummer: P7373
Alternativnummer: ABN-P7373-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human FIGF (O43915, 89 a.a. - 205 a.a ) partial recombinant protein expressed in CHO cells.
UniProt: 2277
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
Target-Kategorie: FIGF
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.