IL8 (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P7379
Artikelname: IL8 (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P7379
Hersteller Artikelnummer: P7379
Alternativnummer: ABN-P7379-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human IL8 (P10145, 23 a.a. - 99 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 3576
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Target-Kategorie: IL8
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.