Cxcl1 (Mouse) Recombinant Protein, Mammal

Artikelnummer: ABN-P7380
Artikelname: Cxcl1 (Mouse) Recombinant Protein, Mammal
Artikelnummer: ABN-P7380
Hersteller Artikelnummer: P7380
Alternativnummer: ABN-P7380-5
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Cxcl1 (P12850, 25 a.a. - 96 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 14825
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Target-Kategorie: Cxcl1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.