Il10 (Mouse) Recombinant Protein, Mammal

Artikelnummer: ABN-P7381
Artikelname: Il10 (Mouse) Recombinant Protein, Mammal
Artikelnummer: ABN-P7381
Hersteller Artikelnummer: P7381
Alternativnummer: ABN-P7381-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Il10 (P18893, 19 a.a. - 178 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 16153
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLKCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS
Target-Kategorie: Il10
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.