Il10 (Rat) Recombinant Protein, Mammal
Artikelnummer:
ABN-P7385
- Bilder (0)
Artikelname: | Il10 (Rat) Recombinant Protein, Mammal |
Artikelnummer: | ABN-P7385 |
Hersteller Artikelnummer: | P7385 |
Alternativnummer: | ABN-P7385-10 |
Hersteller: | Abnova |
Wirt: | Mammal |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Rat |
Rat Il10 (P29456, 19 a.a. - 178 a.a.) partial recombinant Protein expressed in CHO cells. |
Tag: | None |
UniProt: | 25325 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Formulierung: | Lyophilized |
Sequenz: | SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN |
Target-Kategorie: | Il10 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |