IL7 (Human) Recombinant Protein, Mammal
Artikelnummer:
ABN-P7387
- Bilder (0)
Artikelname: | IL7 (Human) Recombinant Protein, Mammal |
Artikelnummer: | ABN-P7387 |
Hersteller Artikelnummer: | P7387 |
Alternativnummer: | ABN-P7387-25 |
Hersteller: | Abnova |
Wirt: | Mammal |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein with His tag expressed in CHO cells. |
Tag: | His |
UniProt: | 3574 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Formulierung: | Lyophilized |
Sequenz: | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNST |
Target-Kategorie: | IL7 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |