IL7 (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P7387
Artikelname: IL7 (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P7387
Hersteller Artikelnummer: P7387
Alternativnummer: ABN-P7387-25
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein with His tag expressed in CHO cells.
Tag: His
UniProt: 3574
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNST
Target-Kategorie: IL7
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.