CCL20 (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P7397
Artikelname: CCL20 (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P7397
Hersteller Artikelnummer: P7397
Alternativnummer: ABN-P7397-5
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human CCL20 (P78556, 27 a.a. - 96 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 6364
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Target-Kategorie: CCL20
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.