CCL20 (Human) Recombinant Protein, Mammal
Artikelnummer:
ABN-P7397
- Bilder (0)
Artikelname: | CCL20 (Human) Recombinant Protein, Mammal |
Artikelnummer: | ABN-P7397 |
Hersteller Artikelnummer: | P7397 |
Alternativnummer: | ABN-P7397-5 |
Hersteller: | Abnova |
Wirt: | Mammal |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human CCL20 (P78556, 27 a.a. - 96 a.a.) partial recombinant protein expressed in CHO cells. |
Tag: | None |
UniProt: | 6364 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Formulierung: | Lyophilized |
Sequenz: | ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM |
Target-Kategorie: | CCL20 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |