HBEGF (Human) Recombinant Protein, Mammal
Artikelnummer:
ABN-P7402
- Bilder (0)
Artikelname: | HBEGF (Human) Recombinant Protein, Mammal |
Artikelnummer: | ABN-P7402 |
Hersteller Artikelnummer: | P7402 |
Alternativnummer: | ABN-P7402-5 |
Hersteller: | Abnova |
Wirt: | Mammal |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human HBEGF (Q99075, 63 a.a. - 148 a.a.) partial recombinant protein expressed in CHO cells. |
Tag: | None |
UniProt: | 1839 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL. |
Formulierung: | Lyophilized |
Sequenz: | DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL |
Target-Kategorie: | HBEGF |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |