HBEGF (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P7402
Artikelname: HBEGF (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P7402
Hersteller Artikelnummer: P7402
Alternativnummer: ABN-P7402-5
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human HBEGF (Q99075, 63 a.a. - 148 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 1839
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
Target-Kategorie: HBEGF
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.