Igf1 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P7405
Artikelname: Igf1 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P7405
Hersteller Artikelnummer: P7405
Alternativnummer: ABN-P7405-10
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Rat
Rat Igf1 (P08025, 49 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli.
Tag: None
UniProt: 24482
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
Target-Kategorie: Igf1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.