Igf1 (Rat) Recombinant Protein, E. coli
Artikelnummer:
ABN-P7405
- Bilder (0)
Artikelname: | Igf1 (Rat) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P7405 |
Hersteller Artikelnummer: | P7405 |
Alternativnummer: | ABN-P7405-10 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Rat |
Rat Igf1 (P08025, 49 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli. |
Tag: | None |
UniProt: | 24482 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Formulierung: | Lyophilized |
Sequenz: | GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA |
Target-Kategorie: | Igf1 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |