IGF2 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7406
Artikelname: IGF2 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7406
Hersteller Artikelnummer: P7406
Alternativnummer: ABN-P7406-10
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human IGF2 ( P01344-1, 25 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
Tag: None
UniProt: 3481
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Target-Kategorie: IGF2
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.