IGF2 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P7406
- Bilder (0)
Artikelname: | IGF2 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P7406 |
Hersteller Artikelnummer: | P7406 |
Alternativnummer: | ABN-P7406-10 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human IGF2 ( P01344-1, 25 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli. |
Tag: | None |
UniProt: | 3481 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Formulierung: | Lyophilized |
Sequenz: | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
Target-Kategorie: | IGF2 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |