TGFA (Human) Recombinant Protein
Artikelnummer:
ABN-P7409
- Bilder (0)
| Artikelname: | TGFA (Human) Recombinant Protein |
| Artikelnummer: | ABN-P7409 |
| Hersteller Artikelnummer: | P7409 |
| Alternativnummer: | ABN-P7409-5 |
| Hersteller: | Abnova |
| Wirt: | Human |
| Kategorie: | Proteine/Peptide |
| Applikation: | FA, SDS-PAGE |
| Spezies Reaktivität: | Human |
| Human TGFA (P01135, 40 a.a. - 89 a.a.) partial recombinant protein expressed in CHO cells. |
| Tag: | None |
| UniProt: | 7039 |
| Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL. |
| Formulierung: | Lyophilized |
| Sequenz: | VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA |
| Target-Kategorie: | TGFA |
| Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
Produktgarantie und fachkundiger Support
