CSNK2B (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7877
Artikelname: CSNK2B (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7877
Hersteller Artikelnummer: P7877
Alternativnummer: ABN-P7877-500
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Human CSNK2B (P67870, 1 a.a. - 215 a.a.) full-length recombinant protein expressed in Escherichia coli.
UniProt: 1460
Puffer: In 20mM Tris-HCl buffer, 0.15M NaCl, pH 8.0 (10% glycerol, 1mM DTT, 1mM EDTA)
Formulierung: Liquid
Sequenz: MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Target-Kategorie: CSNK2B
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.