CSNK2B (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P7877
- Bilder (0)
Artikelname: | CSNK2B (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P7877 |
Hersteller Artikelnummer: | P7877 |
Alternativnummer: | ABN-P7877-500 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Spezies Reaktivität: | Human |
Human CSNK2B (P67870, 1 a.a. - 215 a.a.) full-length recombinant protein expressed in Escherichia coli. |
UniProt: | 1460 |
Puffer: | In 20mM Tris-HCl buffer, 0.15M NaCl, pH 8.0 (10% glycerol, 1mM DTT, 1mM EDTA) |
Formulierung: | Liquid |
Sequenz: | MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR |
Target-Kategorie: | CSNK2B |
Application Verdünnung: | SDS-PAGEThe optimal working dilution should be determined by the end user. |