Il3ra (Mouse) Recombinant Protein, Virus

Artikelnummer: ABN-P7918
Artikelname: Il3ra (Mouse) Recombinant Protein, Virus
Artikelnummer: ABN-P7918
Hersteller Artikelnummer: P7918
Alternativnummer: ABN-P7918-50
Hersteller: Abnova
Wirt: Virus
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Il3ra (P26952, 17 a.a. - 331 a.a.) partial recombinant protein with hIgG-His tag expressed in Baculovirus.
Tag: hIgG-His
UniProt: 16188
Puffer: In 20mM Tris-HCl buffer, 0.1M NaCl, pH 8.0 (30% glycerol)
Formulierung: Liquid
Sequenz: SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQ
Target-Kategorie: Il3ra
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.