IL3 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8258
Artikelname: IL3 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8258
Hersteller Artikelnummer: P8258
Alternativnummer: ABN-P8258-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL3 (P08700, 20 a.a. - 152 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3562
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: APAPTTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Target-Kategorie: IL3
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.