Il3 (Mouse) Recombinant Protein, Insect

Artikelnummer: ABN-P8260
Artikelname: Il3 (Mouse) Recombinant Protein, Insect
Artikelnummer: ABN-P8260
Hersteller Artikelnummer: P8260
Alternativnummer: ABN-P8260-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Il3 (P01586, 27 a.a. - 166 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 16187
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVECLEHHHHHH
Target-Kategorie: Il3
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.