IL3RA (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8264
Artikelname: IL3RA (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8264
Hersteller Artikelnummer: P8264
Alternativnummer: ABN-P8264-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL3RA (P26951 , 20 a.a. - 305 a.a.) partial recombinant protein with His tag at C-teminus expressed in Sf9 cells.
Tag: His
UniProt: 3563
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADLKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTV
Target-Kategorie: IL3RA
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.