Il3ra (Mouse) Recombinant Protein, Insect

Artikelnummer: ABN-P8265
Artikelname: Il3ra (Mouse) Recombinant Protein, Insect
Artikelnummer: ABN-P8265
Hersteller Artikelnummer: P8265
Alternativnummer: ABN-P8265-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Mouse Il3ra (P26952, 17 a.a. - 331 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 16188
Puffer: In 20mM Tris-HCl buffer pH 8.0 (0.1M NaCl, 30% glycerol)
Formulierung: Liquid
Sequenz: SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQ
Target-Kategorie: Il3ra
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.