Il5 (Mouse) Recombinant Protein, Mammal

Artikelnummer: ABN-P8280
Artikelname: Il5 (Mouse) Recombinant Protein, Mammal
Artikelnummer: ABN-P8280
Hersteller Artikelnummer: P8280
Alternativnummer: ABN-P8280-2
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Il5 (P04401, 21 a.a. - 133 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Tag: His
UniProt: 16191
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: DGSMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEGHHHHHH
Target-Kategorie: Il5
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.