IL5 (Canine) Recombinant Protein, Insect

Artikelnummer: ABN-P8284
Artikelname: IL5 (Canine) Recombinant Protein, Insect
Artikelnummer: ABN-P8284
Hersteller Artikelnummer: P8284
Alternativnummer: ABN-P8284-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Canine IL5 (Q95J76, 22 a.a. - 134 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 403790
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPESHHHHHH
Target-Kategorie: IL5
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.