IL5RA (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8285
Artikelname: IL5RA (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8285
Hersteller Artikelnummer: P8285
Alternativnummer: ABN-P8285-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL5RA (Q01344, 21 a.a. - 342 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3568
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADPDLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFD
Target-Kategorie: IL5RA
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.