IL6 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8287
Artikelname: IL6 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8287
Hersteller Artikelnummer: P8287
Alternativnummer: ABN-P8287-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL6 (P05231, 30 a.a. - 212 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 3569
Puffer: In PBS pH 7.4
Formulierung: Lyophilized
Sequenz: MPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Target-Kategorie: IL6
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.