IL6 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8288
Artikelname: IL6 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8288
Hersteller Artikelnummer: P8288
Alternativnummer: ABN-P8288-50
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL6 (P05231, 30 a.a. - 212 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 3569
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Target-Kategorie: IL6
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.