IL6 (Rhesus Macaque) Recombinant Protein, E. coli

Artikelnummer: ABN-P8295
Artikelname: IL6 (Rhesus Macaque) Recombinant Protein, E. coli
Artikelnummer: ABN-P8295
Hersteller Artikelnummer: P8295
Alternativnummer: ABN-P8295-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rhesus Macaque IL6 (P51494, 30 a.a. - 212 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 705819
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: MAPVLPGEDSKNVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSNLRALRQM
Target-Kategorie: IL6
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.