IL6 (Canine) Recombinant Protein, Insect

Artikelnummer: ABN-P8296
Artikelname: IL6 (Canine) Recombinant Protein, Insect
Artikelnummer: ABN-P8296
Hersteller Artikelnummer: P8296
Alternativnummer: ABN-P8296-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Canine IL6 (P41323, 30 a.a. - 212 a.a.) partial recombinant protein with His at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 403985
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: FPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDECVKHTTIHLILRSLEDFLQFSLRAVRIMLEHHHHHH
Target-Kategorie: IL6
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.