IL6R (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8297
Artikelname: IL6R (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8297
Hersteller Artikelnummer: P8297
Alternativnummer: ABN-P8297-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL6R (P08887, 20 a.a. - 357 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 3570
Puffer: In 20mM Tris-HCl buffer pH 8.0 (0.8M Urea, 50% glycerol)
Formulierung: Liquid
Sequenz: LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL
Target-Kategorie: IL6R
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.