IL6R (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8299
Artikelname: IL6R (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8299
Hersteller Artikelnummer: P8299
Alternativnummer: ABN-P8299-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL6R (P08887, 20 a.a. - 357 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3570
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADPLAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVAS_x005F_x005FSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVT
Target-Kategorie: IL6R
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.