IL6ST (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8300
Artikelname: IL6ST (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8300
Hersteller Artikelnummer: P8300
Alternativnummer: ABN-P8300-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL6ST (Q17RA0, 23 a.a. - 619 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3572
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDRGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPED
Target-Kategorie: IL6ST
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.