IL7 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8301
Artikelname: IL7 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8301
Hersteller Artikelnummer: P8301
Alternativnummer: ABN-P8301-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 3574
Puffer: In PBS pH 7.4
Formulierung: Lyophilized
Sequenz: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Target-Kategorie: IL7
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.