IL7 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8305
Artikelname: IL7 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8305
Hersteller Artikelnummer: P8305
Alternativnummer: ABN-P8305-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3574
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADPDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH
Target-Kategorie: IL7
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.