Il7 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P8307
Artikelname: Il7 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P8307
Hersteller Artikelnummer: P8307
Alternativnummer: ABN-P8307-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Rat Il7 (P56478, 26 a.a. - 154 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 25647
Puffer: In PBS pH 7.4
Formulierung: Lyophilized
Sequenz: DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILKGSI
Target-Kategorie: Il7
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.