IL9 (Human) Recombinant Protein, Insect
Artikelnummer:
ABN-P8310
- Bilder (0)
Artikelname: | IL9 (Human) Recombinant Protein, Insect |
Artikelnummer: | ABN-P8310 |
Hersteller Artikelnummer: | P8310 |
Alternativnummer: | ABN-P8310-2 |
Hersteller: | Abnova |
Wirt: | Insect |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human IL9 (P15248, 19 a.a. - 144 a.a.) partial recombinant protein including an 18 a.a. signal peptide (1-18 aa) with His tag at C-terminus expressed in Sf9 cells. |
Tag: | His |
UniProt: | 3578 |
Puffer: | In PBS pH 7.4 (10% glycerol) |
Formulierung: | Liquid |
Sequenz: | MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKIHHHHHH |
Target-Kategorie: | IL9 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |