IL9 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8311
Artikelname: IL9 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8311
Hersteller Artikelnummer: P8311
Alternativnummer: ABN-P8311-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL9 (P15248, 19 a.a. - 144 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3578
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTN TTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKIHHHHHH
Target-Kategorie: IL9
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.