Il9 (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P8312
Artikelname: Il9 (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P8312
Hersteller Artikelnummer: P8312
Alternativnummer: ABN-P8312-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Il9 (P15247, 18 a.a. - 144 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 16198
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: MQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTMSFLKSLLGTFQKTEMQRQKSRP
Target-Kategorie: Il9
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.