IL10 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8315
Artikelname: IL10 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8315
Hersteller Artikelnummer: P8315
Alternativnummer: ABN-P8315-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL10 (P22301, 19 a.a. - 178 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 3586
Puffer: In 20mM Tris-HCl buffer pH 8.0 (20% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Target-Kategorie: IL10
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.