IL10 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P8315
- Bilder (0)
Artikelname: | IL10 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P8315 |
Hersteller Artikelnummer: | P8315 |
Alternativnummer: | ABN-P8315-2 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human IL10 (P22301, 19 a.a. - 178 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 3586 |
Puffer: | In 20mM Tris-HCl buffer pH 8.0 (20% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
Target-Kategorie: | IL10 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |