IL10 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8316
Artikelname: IL10 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8316
Hersteller Artikelnummer: P8316
Alternativnummer: ABN-P8316-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL10 (P22301, 19 a.a. - 178 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3586
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNHHHHHH
Target-Kategorie: IL10
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.