Il10 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P8318
Artikelname: Il10 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P8318
Hersteller Artikelnummer: P8318
Alternativnummer: ABN-P8318-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Il10 (P29456, 19 a.a. - 178 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 25325
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
Target-Kategorie: Il10
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.