IL10RB (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8321
Artikelname: IL10RB (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8321
Hersteller Artikelnummer: P8321
Alternativnummer: ABN-P8321-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL10RB (Q08334, 20 a.a. - 220 a.a.) partial recombinant protein with hlgG-His tag at C-terminus expressed in Sf9 cells.
Tag: hlgG-His
UniProt: 3588
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS
Target-Kategorie: IL10RB
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.