IL11 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8322
Artikelname: IL11 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8322
Hersteller Artikelnummer: P8322
Alternativnummer: ABN-P8322-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL11 (P20809, 23 a.a. - 199 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 3589
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Target-Kategorie: IL11
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.