IL12 (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P8326
Artikelname: IL12 (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P8326
Hersteller Artikelnummer: P8326
Alternativnummer: ABN-P8326-2
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL12 (P29459, 23 a.a. - 219 a.a., P29460, 23 a.a. - 328 a.a.) partial recombinant protein expressed in HEK293 cells.
UniProt: 3592, 3593
Puffer: In PBS (0.1% endotoxin-free recombinant HAS)
Formulierung: Lyophilized
Sequenz: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQV
Target-Kategorie: IL12A
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.