Il12 (Mouse) Recombinant Protein, Insect

Artikelnummer: ABN-P8333
Artikelname: Il12 (Mouse) Recombinant Protein, Insect
Artikelnummer: ABN-P8333
Hersteller Artikelnummer: P8333
Alternativnummer: ABN-P8333-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Il12 (P43431, 23 a.a. - 215 a.a., P43432, 23 a.a. - 335 a.a.) partial recombinant protein with Il12a His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 16159, 16160
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRV VTINRVMGYLSSAHHHHHHMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVI
Target-Kategorie: Il12a
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.