IL13 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P8337
- Bilder (0)
Artikelname: | IL13 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P8337 |
Hersteller Artikelnummer: | P8337 |
Alternativnummer: | ABN-P8337-2 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Human IL13 (P35225, 35 a.a. - 146 a.a.) partial recombinant protein with a substitution of Q for R at position 112 expressed in Escherichia coli. |
UniProt: | 3596 |
Puffer: | Lyophilized from sterile distilled Water is > 100 ug/mL |
Formulierung: | Lyophilized |
Sequenz: | SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN |
Target-Kategorie: | IL13 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |