IL13 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8337
Artikelname: IL13 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8337
Hersteller Artikelnummer: P8337
Alternativnummer: ABN-P8337-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL13 (P35225, 35 a.a. - 146 a.a.) partial recombinant protein with a substitution of Q for R at position 112 expressed in Escherichia coli.
UniProt: 3596
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Target-Kategorie: IL13
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.