IL13 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8338
Artikelname: IL13 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8338
Hersteller Artikelnummer: P8338
Alternativnummer: ABN-P8338-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL13 (P35225, 21 a.a. - 132 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 3596
Puffer: In 25mM Na-Acetate pH 4.8 (50% glycerol)
Formulierung: Liquid
Sequenz: TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL
Target-Kategorie: IL13
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.