Il15 (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P8348
Artikelname: Il15 (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P8348
Hersteller Artikelnummer: P8348
Alternativnummer: ABN-P8348-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Il15 (P48346, 49 a.a. - 162 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
UniProt: 16168
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMNWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILH EYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
Target-Kategorie: Il15
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.