Il15 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P8349
Artikelname: Il15 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P8349
Hersteller Artikelnummer: P8349
Alternativnummer: ABN-P8349-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Il15 (P97604, 48 a.a. - 162 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
UniProt: 25670
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: MNWIDVRYDLEKIESLIQFIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVIESGCKECEELEERNFTEFLQSFIHIVQMFINTS
Target-Kategorie: Il15
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.