Il15 (Rat) Recombinant Protein, E. coli
Artikelnummer:
ABN-P8349
- Bilder (0)
Artikelname: | Il15 (Rat) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P8349 |
Hersteller Artikelnummer: | P8349 |
Alternativnummer: | ABN-P8349-2 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Rat Il15 (P97604, 48 a.a. - 162 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
UniProt: | 25670 |
Puffer: | Lyophilized from sterile distilled Water is > 100 ug/mL |
Formulierung: | Lyophilized |
Sequenz: | MNWIDVRYDLEKIESLIQFIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVIESGCKECEELEERNFTEFLQSFIHIVQMFINTS |
Target-Kategorie: | Il15 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |